518-831-8000 sales@utechproducts.com

Pla2r1 Rabbit Anti-Human, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Pla2r1, Each

1,757.70

Details

Secretory phospholipases a2 (pla2s) have been purified from a variety of mammalian tissues as well as from insect and snake venoms. The prototype group i pla2, the pancreatic pla2 (pla2g1b; mim 172410), is involved in digestion, smooth muscle contraction, and cell proliferation. The prototype group ii pla2, the inflammatory-type pla2 (pla2g2a; mim 172411), is involved in inflammatory conditions and is upregulated by proinflammatory cytokines like tumor necrosis factor (tnf; mim 191160) and interleukin-1 (e.G., Il1b; mim 147720). Differential toxicity of snake venom pla2 appears to be linked to a variety of high-affinity receptors in different organs (ancian et al., 1995 [Pubmed 7721806]).[Supplied by omimsequence: eektwhealrscqadnsaliditslaeveflvtllgdenasetwiglssnkipvsfewsndssviftnwhtlephifpnrsqlcvsaeqseghwkvknceerlfyickkaghvlsdaesgcqegwerhggfcykid

Additional Information

SKU 10292003
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB28009