Pigx, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Pigx, Each
$ 1,757.70
|
|
Details
Glycosylphosphatidylinositol (gpi) is a complex glycolipid that anchors many proteins to the cell surface. Pigx is a subunit of a gpi mannosyltransferase complex involved in the synthesis of the core gpi structure in the endoplasmic reticulum (er) (ashida et al., 2005 [Pubmed 15635094]).[Supplied by omimsequence: mcseiilrqevlkdgfhrdllikvkfgesiedlhtcrllikqdipaglyvdpyelaslrerniteavmvsenfdieapnylskesevliyarrdsqcidcfqaflpvhcryhrphsedgeasivvnnpdllmfcd
Additional Information
| SKU | 10288372 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB22284 |
