Pcmt1, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Pcmt1, Each
|
|
Details
Three classes of protein carboxyl methyltransferases, distinguished by their methyl-acceptor substrate specificity, have been found in prokaryotic and eukaryotic cells. The type ii enzyme catalyzes the transfer of a methyl group from s-adenosyl-l-methionine to the free carboxyl groups of d-aspartyl and l-isoaspartyl residues. These methyl-accepting residues result from the spontaneous deamidation, isomerization, and racemization of normal l-aspartyl and l-asparaginyl residues and represent sites of covalent damage to aging proteins pcmt1 (ec 2.1.1.77) Is a protein repair enzyme that initiates the conversion of abnormal d-aspartyl and l-isoaspartyl residues to the normal l-aspartyl form.[Supplied by omimsequence: akaldvgsgsgiltacfarmvgctgkvigidhikelvddsvnnvrkddptllssgrvqlvvgdgrmgyaeeapydaihvgaaapvvpqalidqlkpggrlilpvgpaggnqmleqydklqdgsikmkplmgviyvpltdkekqws
Additional Information
| SKU | 10292558 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB28722 |
