518-831-8000 sales@utechproducts.com

Pacs1 Rabbit Anti-Human, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Pacs1, Each

1,773.90

Details

This gene encodes a protein with a putative role in the localization of trans-golgi network (tgn) membrane proteins. Mouse and rat homologs have been identified and studies of the homologous rat protein indicate a role in directing tgn localization of furin by binding to the protease's phosphorylated cytosolic domain. In addition, the human protein plays a role in hiv-1 nef-mediated downregulation of cell surface mhc-i molecules to the tgn, thereby enabling hiv-1 to escape immune surveillance. [Provided by refseqsequence: dttspmelaalekikstwiknqddsltetdtleitdqdmfgdastslvvpekvktpmkssktdlqgsaspskvegvhtprqkrstplkerqlskplse

Additional Information

SKU 10289293
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB23363