Olig2 Rabbit Anti-Human, Rat, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Olig2, Each
$ 1,757.70
|
|
Details
This gene encodes a basic helix-loop-helix transcription factor which is expressed in oligodendroglial tumors of the brain. The protein is an essential regulator of ventral neuroectodermal progenitor cell fate. The gene is involved in a chromosomal translocation t(14;21)(q11.2;Q22) associated with t-cell acute lymphoblastic leukemia. Its chromosomal location is within a region of chromosome 21 which has been suggested to play a role in learning deficits associated with down syndrome. [Provided by refseqsequence: spepddlflparskgssgsaftggtvssstpsdcppelsaelrgamgsagahpgdklggsgfkssssstssstssaaasstkkdkkqmtepelqqlrlkinsrerkrmhdlni
Additional Information
| SKU | 10292563 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB28727 |
