518-831-8000 sales@utechproducts.com

Nxph1 Rabbit Anti-Human, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Nxph1, Each

1,757.70

Details

This gene is a member of the neurexophilin family and encodes a secreted protein with a variable n-terminal domain, a highly conserved, n-glycosylated central domain, a short linker region, and a cysteine-rich c-terminal domain. This protein forms a very tight complex with alpha neurexins, a group of proteins that promote adhesion between dendrites and axons. [Provided by refseqsequence: nltnggksellksgsskstlkhiwtesskdlsisrllsqtfrgkendtdldlrydtpepyseqdlwdwlrnstdlqeprprakrrpivktgkfkkmfgw

Additional Information

SKU 10292015
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB28021