Nsun2, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Nsun2, Each
$ 1,757.70
|
|
Details
Maturation of cytoplasmic trnas includes splicing of introns, which are located 1 nucleotide 3-prime from the anticodon in all intron-containing trna genes. In trna-leu(caa), the first position of the anticodon, c34, is converted to 5-methylcytosine, a modification necessary to stabilize the anticodon-codon pairing and correctly translate the mrna. Nsun2 encodes a methyltransferase that catalyzes the intron-dependent formation of 5-methylcytosine at c34 of trna-leu(caa) (brzezicha et al., 2006 [Pubmed 17071714]).[Supplied by omimsequence: pfvfipeddplfppiekfyaldpsfprmnlltrttegkkrqlymvskelrnvllnnsekmkvintgikvwcrnnsgeefdcafrlaq
Additional Information
| SKU | 10289139 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB23182 |
