518-831-8000 sales@utechproducts.com

MTR Antibody Blocking Peptide, Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition, Each

294.98

Details:

A blocking peptide from human MTR. Source: Synthetic Amino Acid Sequence: (Accession #: NP_000245) GSEQLDVADLRRLRYKGIRPAPGYPSQPDHTEKLTMWRLADIEQSTGIRL. The MTR Blocking Peptide is derived from Synthetic. The MTR Blocking Peptide has been validated for the following applications: Antibody Competition.

Additional Information

SKU 10177848
UOM Each
UNSPSC 41105906
Manufacturer Part Number NBP179285PEP