Nkain4, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Nkain4, Each
$ 1,757.70
|
|
Details
Nkain4 is a member of a family of mammalian proteins (see nkain1; mim 612871) with similarity to drosophila nkain and interacts with the beta subunit of na,k-atpase (atp1b1; mim 182330) (gorokhova et al., 2007 [Pubmed 17606467]).[Supplied by omimsequence: lkdselltfslsrhrswwrerwpgclheevpavglgaphgqalvsgagcalepsyvealhsclqiliallgfvcgcqvvsvfteeedsfdfiggfdpfplyhvnekpssllskqvy
Additional Information
| SKU | 10288435 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB22361 |
