Ngly1, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Ngly1, Each
$ 1,773.90
|
|
Details
This gene encodes an enzyme that catalyzes hydrolysis of an n(4)-(acetyl-beta-d-glucosaminyl) asparagine residue to n-acetyl-beta-d-glucosaminylamine and a peptide containing an aspartate residue. The encoded enzyme may play a role in the proteasome-mediated degradation of misfolded glycoproteins. Multiple transcript variants encoding different isoforms have been found for this genesequence: isdedflllellhwfkeeffhwvnnvlcskcggqtrsrdrsllpsddelkwgakevedhycdacqfsnrfprynnpeklletrcgr
Additional Information
| SKU | 10289038 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB23068 |
