518-831-8000 sales@utechproducts.com

Ndufaf3, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Ndufaf3, Each

1,821.15

Details

This gene encodes a mitochondrial complex i assembly protein that interacts with complex i subunits. Mutations in this gene cause mitochondrial complex i deficiency, a fatal neonatal disorder of the oxidative phosphorylation system. Alternatively spliced transcript variants encoding different isoforms have been identified. [Provided by refseqsequence: lleprieivvvgtgdrterlqsqvlqamrqrgiavevqdtpnacatfnflchegrvtgaalipppggtsltslgqaaq

Additional Information

SKU 10288875
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB22870