518-831-8000 sales@utechproducts.com

Ndp Rabbit Anti-Human, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Ndp, Each

1,757.70

Details

This gene encodes a secreted protein with a cystein-knot motif that activates the wnt/beta-catenin pathway. The protein forms disulfide-linked oligomers in the extracellular matrix. Mutations in this gene result in norrie disease and x-linked exudative vitreoretinopathy. [Provided by refseqsequence: tdssfimdsdprrcmrhhyvdsishplykcsskmvllarceghcsqasrseplvsfstvlkqpfrsschccrpqtsklkalrlrcsggmrltatyryilschceecns

Additional Information

SKU 10292491
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB28650