Nav1 Rabbit Anti-Human, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Nav1, Each
$ 1,757.70
|
|
Details
This gene belongs to the neuron navigator family and is expressed predominantly in the nervous system. The encoded protein contains coiled-coil domains and a conserved aaa domain characteristic for atpases associated with a variety of cellular activities. This gene is similar to unc-53, a caenorhabditis elegans gene involved in axon guidance. The exact function of this gene is not known. [Provided by refseqsequence: aksfvkppslanldkvnsnsldlpsssdtthaskvpdlhatssasggplpscftpspapilninsasfsqglelmsgfsvpketrmypklsglhrsmeslqmpmslpsafpsstpvptppappaapteeeteeltwsgsp
Additional Information
| SKU | 10288204 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB22080 |
