Napepld Rabbit Anti-Human, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Napepld, Each
$ 1,757.70
|
|
Details
Napepld is a phospholipase d type enzyme that catalyzes the release of n-acylethanolamine (nae) from n-acyl-phosphatidylethanolamine (nape) in the second step of the biosynthesis of n-acylethanolamine (okamoto et al., 2004 [Pubmed 14634025]).[Supplied by omimsequence: mkyqhvdpeeavrihtdvqtkksmaihwgtfalanehyleppvklnealeryglnaedffvlkhgesrylnndde
Additional Information
| SKU | 10287468 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB21247 |
