Nalcn Rabbit Anti-Human, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Nalcn, Each
$ 1,757.70
|
|
Details
Nalcn forms a voltage-independent, nonselective, noninactivating cation channel permeable to na , k , and ca(2 ). It is responsible for the neuronal background sodium leak conductance (lu et al., 2007 [Pubmed 17448995]).[Supplied by omimsequence: tyhcvvndtkpgnvtwnslaipdthcspeleegyqcppgfkcmdledlglsrqelgysgfne
Additional Information
| SKU | 10288803 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB22787 |
