518-831-8000 sales@utechproducts.com

Mtif2, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Mtif2, Each

1,757.70

Details

During the initiation of protein biosynthesis, initiation factor-2 (if-2) promotes the binding of the initiator trna to the small subunit of the ribosome in a gtp-dependent manner. Prokaryotic if-2 is a single polypeptide, while eukaryotic cytoplasmic if-2 (eif-2) is a trimeric protein. Bovine liver mitochondria contain if-2(mt), an 85kda monomeric protein that is equivalent to prokaryotic if-2. The predicted 727-amino acid human protein contains a 29-amino acid presequence. Human if-2(mt) shares 32 to 38% amino acid sequence identity with yeast if-2(mt) and several prokaryotic if-2s, with the greatest degree of conservation in the g domains of the proteins. Two transcript variants encoding the same protein have been found for this gene. [Provided by refseqsequence: rkeqiplkpkekrerdsnvlsviikgdvdgsveailniidtydashecelelvhfgvgdisandvnlaetfdgviygfnvnagnviqqsaakkgvkiklhkiiyrlvedlqeelssrlpcaveehpvgeasilatfsvtegkkkvpvagc

Additional Information

SKU 10286676
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB20335