msh homeobox 1, Mouse, Clone: 1D2, Abnova, Mouse monoclonal antibody raised against a full-length recombinant MSX1, Each

$ 650.70
|
Details
This gene encodes a member of the muscle segment homeobox gene family. The encoded protein functions as a transcriptional repressor during embryogenesis through interactions with components of the core transcription complex and other homeoproteins. It may also have roles in limb-pattern formation, craniofacial development, particularly odontogenesis, and tumor growth inhibition. Mutations in this gene, which was once known as homeobox 7, have been associated with nonsyndromic cleft lip with or without cleft palate 5, Witkop syndrome, Wolf-Hirschom syndrome, and autosomoal dominant hypodontia. [provided by RefSeqSequence: NRRAKAKRLQEAELEKLKMAAKPMLPPAAFGLSFPLGGPAAVAAAAGASLYGASGPFQRAALPVAPVGLYTAHVGYSMYHLT
Additional Information
SKU | 10418033 |
---|---|
UOM | Each |
UNSPSC | 12352200 |
Manufacturer Part Number | H00004487M05 |