Mpdu1, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Mpdu1, Each
$ 1,757.70
|
|
Details
This gene encodes an endoplasmic reticulum membrane protein that is required for utilization of the mannose donor mannose-p-dolichol in the synthesis of lipid-linked oligosaccharides and glycosylphosphatidylinositols. Mutations in this gene result in congenital disorder of glycosylation type if. Alternative splicing results in multiple transcript variants. [Provided by refseqsequence: aeadgplkrllvpillpekcydqlfvqwdllhvpclkillsk
Additional Information
| SKU | 10287056 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB20774 |
