Mllt4 Rabbit Anti-Human, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Mllt4, Each
$ 1,757.70
|
|
Details
Af6 is a ras (see hras; mim 190020) target that regulates cell-cell adhesions downstream of ras activation. It is fused with mll (mim 159555) in leukemias caused by t(6;11) translocations (taya et al., 1998 [Pubmed 9722616]).[Supplied by omimsequence: kpekpstlqrpqetvirelqpqqqprtierrdlqyitvskeelssgdslspdpwkrdakeklekqqqmhivdmlskeiqelqskpdrsaeesdrlrklmlewq
Additional Information
| SKU | 10288482 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB22418 |
