Mkl1 Rabbit Anti-Human, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Mkl1, Each
$ 1,757.70
|
|
Details
The protein encoded by this gene interacts with the transcription factor myocardin, a key regulator of smooth muscle cell differentiation. The encoded protein is predominantly nuclear and may help transduce signals from the cytoskeleton to the nucleus. This gene is involved in a specific translocation event that creates a fusion of this gene and the rna-binding motif protein-15 gene. This translocation has been associated with acute megakaryocytic leukemia. [Provided by refseqsequence: eqekraqqpapapaplgtpvkqensfsscqlsqqplgpahpfnpslaapatnhidpcavapgppsvvvkqealqpepepvpapqlllgpqgpslikgvapptlitdstgthlvltvtnknadspg
Additional Information
| SKU | 10288546 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB22486 |
