Me3 Rabbit Anti-Human, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Me3, Each
$ 1,757.70
|
|
Details
Malic enzyme catalyzes the oxidative decarboxylation of malate to pyruvate using either nad or nadp as a cofactor. Mammalian tissues contain 3 distinct isoforms of malic enzyme: a cytosolic nadp( )-dependent isoform, a mitochondrial nadp( )-dependent isoform, and a mitochondrial nad( )-dependent isoform. This gene encodes a mitochondrial nadp( )-dependent isoform. Multiple alternatively spliced transcript variants have been found for this gene, but the biological validity of some variants has not been determined. [Provided by refseqsequence: dvslriaikvldyaykhnlasyypepkdkeafvrslvytpdydsftldsytwpkeamnvqtv
Additional Information
| SKU | 10289232 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB23293 |
