Mcoln3, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Mcoln3, Each
$ 1,757.70
|
|
Details
Mucolipins constitute a family of cation channel proteins with homologs in mouse, drosophila, and c. Elegans. Mutations in the human mcoln1 gene (mim 605248) cause mucolipodosis iv (mim 262650).[Supplied by omimsequence: yenkgtkqsamaicqhfykrgniypgndtfdidpeietecffvepdepfhigtpaenklnltldfhrlltvelqfklkainlqtvrhqelpdcydftlt
Additional Information
| SKU | 10287259 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB21014 |
