Matr3 Rabbit Anti-Human, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Matr3, Each
$ 1,757.70
|
|
Details
The protein encoded by this gene is localized in the nuclear matrix. It may play a role in transcription or may interact with other nuclear matrix proteins to form the internal fibrogranular network. Two transcript variants encoding the same protein have been identified for this gene. [Provided by refseqsequence: lkrrrteegptlsygrdgrsatreppyrvprddweekrhfrrdsfddrgpslnpvldydhgsrsqesgyydrmdyeddrlrdgercrdd
Additional Information
| SKU | 10289005 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB23027 |
