Map1b, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Map1b, Each
$ 1,757.70
|
|
Details
This gene encodes a protein that belongs to the microtubule-associated protein family. The proteins of this family are thought to be involved in microtubule assembly, which is an essential step in neurogenesis. The product of this gene is a precursor polypeptide that presumably undergoes proteolytic processing to generate the final map1b heavy chain and lc1 light chain. Gene knockout studies of the mouse microtubule-associated protein 1b gene suggested an important role in development and function of the nervous system. [Provided by refseqsequence: evveehcaspedktlevvspsqsvtgsaghtpyyqsptdeksshlpteviekppavpvsfefsdakdenerasvspmdepvpdsespiekvlsplrsppligsesayesflsaddkasgrgaespfeeksgkqgspdqvspvsemtst
Additional Information
| SKU | 10287678 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB21488 |
