518-831-8000 sales@utechproducts.com

Lyzl6, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Lyzl6, Each

1,757.70

Details

Lysozymes (see lyz; mim 153450), especially c-type lysozymes, are well-recognized bacteriolytic factors widely distributed in the animal kingdom and play a mainly protective role in host defense. Lyzl6 is a member of a family of lysozyme-like genes (zhang et al., 2005 [Pubmed 16014814]).[Supplied by omimsequence: cndyksysenlchvdcqdllnpnllagihcakrivsgargmnnwvewrlhcsgrp

Additional Information

SKU 10287947
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB21780