Lyzl6, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Lyzl6, Each
$ 1,757.70
|
|
Details
Lysozymes (see lyz; mim 153450), especially c-type lysozymes, are well-recognized bacteriolytic factors widely distributed in the animal kingdom and play a mainly protective role in host defense. Lyzl6 is a member of a family of lysozyme-like genes (zhang et al., 2005 [Pubmed 16014814]).[Supplied by omimsequence: cndyksysenlchvdcqdllnpnllagihcakrivsgargmnnwvewrlhcsgrp
Additional Information
| SKU | 10287947 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB21780 |
