Lsm8, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Lsm8, Each
$ 1,757.70
|
|
Details
This gene is a member of the lsm family and encodes a protein with a closed barrel shape, made up of five anti-parallel beta strands and an alpha helix. The protein partners with six paralogs to form a heteroheptameric ring which transiently binds rnas and is involved in the general maturation of rna in the nucleus. [Provided by refseqsequence: alenyinrtvavitsdgrmivgtlkgfdqtinlildeshervfsssqgveqvvlglyivrgdnvavigeideetdsaldlgniraep
Additional Information
| SKU | 10287490 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB21274 |
