Lsm7, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Lsm7, Each
$ 1,757.70
|
|
Details
Sm-like proteins were identified in a variety of organisms based on sequence homology with the sm protein family (see snrpd2; mim 601061). Sm-like proteins contain the sm sequence motif, which consists of 2 regions separated by a linker of variable length that folds as a loop. The sm-like proteins are thought to form a stable heteromer present in tri-snrnp particles, which are important for pre-mrna splicing.[Supplied by omimsequence: rsgilkgfdpllnlvldgtieymrdpddqykltedtrqlglvvcrgtsvvlicpqdgmeaipnpfiqqqd
Additional Information
| SKU | 10291951 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB27913 |
