518-831-8000 sales@utechproducts.com

Lrpprc, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Lrpprc, Each

1,757.70

Details

This gene encodes a protein that is leucine-rich and is thought to play a role in regulating the interaction of the cytoskeleton with a variety of cellular processes. Mutations in this gene are associated with the french-canadian type of leigh syndrome. Transcripts ranging in size from 4.8 To 7.0Kb which result from alternative polyadenylation have been reported for this gene. [Provided by refseqsequence: riwdtlqklgavydvshynallkvylqneykfsptdflakmeeaniqpnrvtyqrliasycnvgdiegaskilgfmktkdlpvt

Additional Information

SKU 10288979
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB22998