Lace1 Rabbit Anti-Human, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Lace1, Each
$ 1,757.70
|
|
Details
This gene encodes a protein with possible atpase function. The protein contains a p-loop motif and a five-domain structure that is conserved in fly, yeast, and bacteria. Two conserved estrogen receptor binding sites are located within 2.5Kb of this gene. [Provided by refseqsequence: wkaytvqtsesmtptatsetylkalavchgpldhydflikahelkddehqrrviqclqklhedlkgynieaeglfsklfsrskpprglyvygdvgtgk
Additional Information
| SKU | 10288469 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB22402 |
