Kif18a, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Kif18a, Each
$ 1,757.70
|
|
Details
Kif18a is a member of the kinesin superfamily of microtubule-associated molecular motors (see mim 148760) that use hydrolysis of atp to produce force and movement along microtubules (luboshits and benayahu, 2005 [pubmed 15878648]).[Supplied by omimsequence: afqnpstvtlmkpssfttsfqaissninsdnclkmlcevaiphnrrkecgqedldstfticediksskcklpeqeslpndnkdilqrldp
Additional Information
| SKU | 10289459 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB23550 |
