518-831-8000 sales@utechproducts.com

Kif18a, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Kif18a, Each

1,757.70

Details

Kif18a is a member of the kinesin superfamily of microtubule-associated molecular motors (see mim 148760) that use hydrolysis of atp to produce force and movement along microtubules (luboshits and benayahu, 2005 [pubmed 15878648]).[Supplied by omimsequence: afqnpstvtlmkpssfttsfqaissninsdnclkmlcevaiphnrrkecgqedldstfticediksskcklpeqeslpndnkdilqrldp

Additional Information

SKU 10289459
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB23550