Kcnk17, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Kcnk17, Each
$ 1,757.70
|
|
Details
The protein encoded by this gene belongs to the family of potassium channel proteins containing two pore-forming p domains. This channel is an open rectifier which primarily passes outward current under physiological k concentrations. This gene is activated at alkaline ph. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [Provided by refseqsequence: cscchhsskedfksqswrqgpdrepeshspqqgcypegpmgiiqhlepsahaagcgkds
Additional Information
| SKU | 10289969 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB24275 |
