Kcnj5 Rabbit Anti-Human, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Kcnj5, Each
$ 1,757.70
|
|
Details
Potassium channels are present in most mammalian cells, where they participate in a wide range of physiologic responses. The protein encoded by this gene is an integral membrane protein and inward-rectifier type potassium channel. The encoded protein, which has a greater tendency to allow potassium to flow into a cell rather than out of a cell, is controlled by g-proteins. It may associate with two other g-protein-activated potassium channels to form a heteromultimeric pore-forming complex. [Provided by refseqsequence: tpvltlekgfyevdyntfhdtyetntpsccakelaemkregrllqylpsppllggcaeagldaeaeqneedepkglgg
Additional Information
| SKU | 10287364 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB21130 |
