518-831-8000 sales@utechproducts.com

Katnb1 Rabbit Anti-Human, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Katnb1, Each

1,757.70

Details

Microtubules, polymers of alpha and beta tubulin subunits, form the mitotic spindle of a dividing cell and help to organize membranous organelles during interphase. Katanin is a heterodimer that consists of a 60kda atpase (p60 subunit a 1) and an 80kda accessory protein (p80 subunit b 1). The p60 subunit acts to sever and disassemble microtubules, while the p80 subunit targets the enzyme to the centrosome. Katanin is a member of the aaa family of atpases. [Provided by refseqsequence: spamdvqfpvpnlevlprppvvastpapkaepaiipatrnepiglkasdflpavkipqqaelvdedamsqirkghdtmcvvltsrhknldtvravwtmgdiktsvdsavaindlsvv

Additional Information

SKU 10289652
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB23761