Irf8 Rabbit Anti-Human, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Irf8, Each
$ 1,757.70
|
|
Details
Interferon consensus sequence-binding protein (icsbp) is a transcription factor of the interferon (ifn) regulatory factor (irf) family. Proteins of this family are composed of a conserved dna-binding domain in the n-terminal region and a divergent c-terminal region that serves as the regulatory domain. The irf family proteins bind to the ifn-stimulated response element (isre) and regulate expression of genes stimulated by type i ifns, namely ifn-alpha and ifn-beta. Irf family proteins also control expression of ifn-alpha and ifn-beta-regulated genes that are induced by viral infection. [Provided by refseqsequence: pdfeevtdrsqldisepykvyrivpeeeqkcklgvatagcvnevtemecgrseidelikepsvddymgmikrspsppeacrsqllpdwwaqqpstgvplvtgyttydahhsafsqmvisfyy
Additional Information
| SKU | 10292428 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB28583 |
