518-831-8000 sales@utechproducts.com

Ints6 Rabbit Anti-Human, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Ints6, Each

1,757.70

Details

Dead box proteins, characterized by the conserved motif asp-glu-ala-asp (dead), are putative rna helicases. The protein encoded by this gene is a dead box protein that is part of a complex that interacts with the c-terminus of rna polymerase ii and is involved in 3' end processing of snrnas. In addition, this gene is a candidate tumor suppressor and located in the critical region of loss of heterozygosity (loh). Three transcript variants encoding two different isoforms have been found for this gene. [Provided by refseqsequence: vvnnhiggkgppapttqaqpdlikplplhkisettndsiihdvvenhvadqlssditpnamdtefsasspasllerptnhmealghdhlgtndltvggflenheeprdkeqcaeenipasslnkgkklmhcrsheevntelkaq

Additional Information

SKU 10292372
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB28493