Ints10, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Ints10, Each
$ 1,757.70
|
|
Details
Ints10 is a subunit of the integrator complex, which associates with the c-terminal domain of rna polymerase ii large subunit (polr2a; mim 180660) and mediates 3-prime end processing of small nuclear rnas u1 (rnu1; mim 180680) and u2 (rnu2; mim 180690) (baillat et al., 2005 [Pubmed 16239144]).[Supplied by omimsequence: kgrrsygdilhrmkdlcrymnnfdseahakyknqvvystmlvffknafqyvnsiqpslfqgpnapsqvplvlledvsnvygd
Additional Information
| SKU | 10289426 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB23514 |
