518-831-8000 sales@utechproducts.com

Insl5, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Insl5, Each

1,757.70

Details

The protein encoded by this gene contains a classical signature of the insulin superfamily and is highly similar to relaxin 3 (rln3/insl7). [Provided by refseqsequence: leyirtviyicassrwrrhlegipqaqqaetgnsfqlphkrefseenpaqnlpkvdasgedrlwggqmpteelwkskkhsvmsr

Additional Information

SKU 10288456
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB22388