518-831-8000 sales@utechproducts.com

Il1rl1 Rabbit Anti-Human, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Il1rl1, Each

1,757.70

Details

The protein encoded by this gene is a member of the interleukin 1 receptor family. Studies of the similar gene in mouse suggested that this receptor can be induced by proinflammatory stimuli, and may be involved in the function of helper t cells. This gene, interleukin 1 receptor, type i (il1r1), interleukin 1 receptor, type ii (il1r2) and interleukin 1 receptor-like 2 (il1rl2) form a cytokine receptor gene cluster in a region mapped to chromosome 2q12. Alternative splicing of this gene results in multiple transcript variants. [Provided by refseqsequence: psytvdwyysqtnksiptqernrvfasgqllkflpaavadsgiytcivrsptfnrtgyanvtiykkqsdcnvpdylmystvsgseknskiycptidlynwtaplewfkncqalqgsry

Additional Information

SKU 10286730
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB20396