Il1rapl2, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Il1rapl2, Each
$ 1,757.70
|
|
Details
The protein encoded by this gene is a member of the interleukin 1 receptor family. This protein is similar to the interleukin 1 accessory proteins, and is most closely related to interleukin 1 receptor accessory protein-like 1 (il1rapl1). This gene and il1rapl1 are located at a region on chromosome x that is associated with x-linked nonsyndromic mental retardation. [Provided by refseqsequence: ttelkvtalltdkppkplfpmenqpsvidvqlgkplnipckaffgfsgesgpmiywmkgekfieelaghiregeirll
Additional Information
| SKU | 10288939 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB22951 |
