518-831-8000 sales@utechproducts.com

Il1rapl2, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Il1rapl2, Each

1,757.70

Details

The protein encoded by this gene is a member of the interleukin 1 receptor family. This protein is similar to the interleukin 1 accessory proteins, and is most closely related to interleukin 1 receptor accessory protein-like 1 (il1rapl1). This gene and il1rapl1 are located at a region on chromosome x that is associated with x-linked nonsyndromic mental retardation. [Provided by refseqsequence: ttelkvtalltdkppkplfpmenqpsvidvqlgkplnipckaffgfsgesgpmiywmkgekfieelaghiregeirll

Additional Information

SKU 10288939
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB22951