Ifngr2, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Ifngr2, Each
$ 1,757.70
|
|
Details
This gene (ifngr2) encodes the nonligand-binding beta chain of the gamma interferon receptor. Human interferon-gamma receptor is a heterodimer of ifngr1 and ifngr2. Defects in ifngr2 are a cause of mendelian susceptibility to mycobacterial disease (msmd), also known as familial disseminated atypical mycobacterial infection. Msmd is a genetically heterogeneous disease with autosomal recessive, autosomal dominant or x-linked inheritance. [Provided by refseqsequence: aspsagfpmdfnvtlrlraelgalhsawvtmpwfqhyrnvtvgppenievtpgegsliirfsspfdiadtstaffcyyvhywekggiqqvkgpfrsnsisldnlkpsrvyclqvqaqllwnksnifrvghlsnis
Additional Information
| SKU | 10292271 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB28384 |
