Human MAP1LC3B Partial ORF (NP_073729, 1 a.a. - 71 a.a.) Recombinant Protein with GST-tag at N-terminal, Used for AP, Array, ELISA, WB-Re, Each

Details

The product of this gene is a subunit of neuronal microtubule-associated MAP1A and MAP1B proteins, which are involved in microtubule assembly and important for neurogenesis. Studies on the rat homolog implicate a role for this gene in autophagy, a process that involves the bulk degradation of cytoplasmic component. [provided by RefSeq]Sequence: MPSEKTFKQRRTFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRRL