Hsd17b4 Rabbit Anti-Human, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Hsd17b4, Each
$ 1,757.70
|
|
Details
The protein encoded by this gene is a bifunctional enzyme that is involved in the peroxisomal beta-oxidation pathway for fatty acids. It also acts as a catalyst for the formation of 3-ketoacyl-coa intermediates from both straight-chain and 2-methyl-branched-chain fatty acids. Defects in this gene that affect the peroxisomal fatty acid beta-oxidation activity are a cause of d-bifunctional protein deficiency (dbpd). An apparent pseudogene of this gene is present on chromosome 8. [Provided by refseqsequence: vnnagilrdrsfarisdedwdiihrvhlrgsfqvtraawehmkkqkygriimtssasgiygnfgqanysaaklgllglanslaiegrksnihcntiapnagsrmtqtvmpedlvealkpeyvaplv
Additional Information
| SKU | 10287616 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB21417 |
