Hnrpll Rabbit Anti-Human, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Hnrpll, Each
$ 1,757.70
|
|
Details
Hnrnpll is a master regulator of activation-induced alternative splicing in t cells. In particular, it alters splicing of cd45 (ptprc; mim 151460), a tyrosine phosphatase essential for t-cell development and activation (oberdoerffer et al., 2008 [Pubmed 18669861]).[Supplied by omimsequence: qaskniiqppscvlhyynvplcvteetftklcndhevltfikykvfdakpsaktlsgllewecktd
Additional Information
| SKU | 10290139 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB24468 |
