518-831-8000 sales@utechproducts.com

Hnrpll Rabbit Anti-Human, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Hnrpll, Each

1,757.70

Details

Hnrnpll is a master regulator of activation-induced alternative splicing in t cells. In particular, it alters splicing of cd45 (ptprc; mim 151460), a tyrosine phosphatase essential for t-cell development and activation (oberdoerffer et al., 2008 [Pubmed 18669861]).[Supplied by omimsequence: qaskniiqppscvlhyynvplcvteetftklcndhevltfikykvfdakpsaktlsgllewecktd

Additional Information

SKU 10290139
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB24468