518-831-8000 sales@utechproducts.com

HDLBP Rabbit anti-Human, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant HDLBP, Each

1,069.20

Details:

High density lipoprotein-binding protein, also known as vigilin, is a 110kDa protein that specifically binds HDL molecules and may function in the removal of excess cellular cholesterol.[supplied by OMIMSequence: DMNQFGEGEQAKICLEIMQRTGAHLELSLAKDQGLSIMVSGKLDAVMKARKDIVARLQTQASATVAIPKEHHRFVIGKNGEKLQDLELKTATKIQIPRPDDPSNQIKITGTKEGIEKARHEVLLISAEQDKRAVE

Additional Information

SKU 10286624
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB20269