Gucy1b3 Rabbit Anti-Human, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Gucy1b3, Each
$ 1,773.90
|
|
Details
Soluble guanylate cyclase (sgc), a heterodimeric protein consisting of an alpha subunit and a beta subunit, typically gucy1b3, catalyzes conversion of gtp to the second messenger cgmp and functions as the main receptor for nitric oxide (no) and nitrovasodilator drugs (zabel et al., 1998 [Pubmed 9742212]).[Supplied by omimsequence: halellvirnygpevwedikkeaqldeegqflvriiyddsktydlvaaaskvlnlnageilqmfgkmffvfcqesgydtilrvlgsnvreflqnldalhdhlatiypgmrapsfrctdaekgkglilhyysereglqdivigii
Additional Information
| SKU | 10287541 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB21333 |
