518-831-8000 sales@utechproducts.com

Gucy1b3 Rabbit Anti-Human, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Gucy1b3, Each

1,773.90

Details

Soluble guanylate cyclase (sgc), a heterodimeric protein consisting of an alpha subunit and a beta subunit, typically gucy1b3, catalyzes conversion of gtp to the second messenger cgmp and functions as the main receptor for nitric oxide (no) and nitrovasodilator drugs (zabel et al., 1998 [Pubmed 9742212]).[Supplied by omimsequence: halellvirnygpevwedikkeaqldeegqflvriiyddsktydlvaaaskvlnlnageilqmfgkmffvfcqesgydtilrvlgsnvreflqnldalhdhlatiypgmrapsfrctdaekgkglilhyysereglqdivigii

Additional Information

SKU 10287541
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB21333