GTF2A2, Mouse, Clone: 2B9, Abnova, Mouse monoclonal antibody raised against a full-length recombinant GTF2A2, Each

|
Details
Accurate transcription initiation on TATA-containing class II genes involves the ordered assembly of RNA polymerase II (POLR2A; MIM 180660) and the general initiation factors TFIIA, TFIIB (MIM 189963), TFIID (MIM 313650), TFIIE (MIM 189962), TFIIF (MIM 189968), TFIIG/TFIIJ, and TFIIH (MIM 189972). The first step involves recognition of the TATA element by the TATA-binding subunit (TBP; MIM 600075) and may be regulated by TFIIA, a factor that interacts with both TBP and a TBP-associated factor (TAF; MIM 600475) in TFIID. TFIIA has 2 subunits (43 and 12kDa) in yeast and 3 subunits in higher eukaryotes. In HeLa extracts, it consists of a 35kDa alpha subunit and a 19kDa beta subunit encoded by the N- and C-terminal regions of GTF2A1 (MIM 600520), respectively, and a 12kDa gamma subunit encoded by GTF2A2 (DeJong et al., 1995 [PubMed 7724559]).[supplied by OMIMSequence: MAYQLYRNTTLGNSLQESLDELIQSQQITPQLALQVLLQFDKAINAALAQRVRNRVNFRGSLNTYRFCDNVWTFVLNDVEFREVTELIKVDKVKIVACDGKNTGSNTTE
Additional Information
SKU | 10417484 |
---|---|
UOM | Each |
UNSPSC | 12352200 |
Manufacturer Part Number | H00002958M01 |