Gpsm2 Rabbit Anti-Human, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Gpsm2, Each
$ 1,757.70
|
|
Details
Heterotrimeric g proteins transduce extracellular signals received by cell surface receptors into integrated cellular responses. Gpsm2 belongs to a group of proteins that modulate activation of g proteins (blumer et al., 2002 [Pubmed 11832491]).[Supplied by omimsequence: fqsnrmddqrcclqeknchtastttsstppkmmlktssvpvvspntdefldllassqsrrlddqrasfsnlpglrltqnsqsvlshlmtndnkeadedffd
Additional Information
| SKU | 10286756 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB20424 |
