Gprc5b Rabbit Anti-Human, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Gprc5b, Each
$ 1,757.70
|
|
Details
The protein encoded by this gene is a member of the type 3 g protein-coupled receptor family. Members of this superfamily are characterized by a signature 7-transmembrane domain motif. The specific function of this protein is unknown; however, this protein may mediate the cellular effects of retinoic acid on the g protein signal transduction cascade. [Provided by refseqsequence: ihctllpalqentpnyfdtsqprmretafeedvqlpraymenkafsmdehnaalrtagfpngslgkrpsgslgkrpsapfrsnvyqptemavvlnggtiptap
Additional Information
| SKU | 10287084 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB20805 |
