Golim4 Rabbit Anti-Human, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Golim4, Each
$ 1,757.70
|
|
Details
The golgi complex plays a key role in the sorting and modification of proteins exported from the endoplasmic reticulum. The protein encoded by this gene is a type ii golgi-resident protein. It may process proteins synthesized in the rough endoplasmic reticulum and assist in the transport of protein cargo through the golgi apparatus. [Provided by refseqsequence: enrqlrkahqdihtqlqdvkqqhknllseheqlvvtledhksalaaaqtqvaeykqlkdtlnripslrkpdpaeqqnvtqvahspqgyntarekptrevqevsrnndvwq
Additional Information
| SKU | 10292402 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB28549 |
