Gldc, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Gldc, Each
$ 1,757.70
|
|
Details
The enzyme system for cleavage of glycine (glycine cleavage system; gcs; ec 2.1.2.10), Which is confined to the mitochondria, is composed of 4 protein components: p protein (a pyridoxal phosphate-dependent glycine decarboxylase), h protein (a lipoic acid-containing protein), t protein (a tetrahydrofolate-requiring enzyme), and l protein (a lipoamide dehydrogenase). Glycine encephalopathy (gce; mim 605899) may be due to a defect in any one of these enzymes; see mim 238310, mim 238330, and mim 238331.[Supplied by omimsequence: ilnanymakrlethyrilfrgargyvghefildtrpfkksanieavdvakrlqdygfhaptmswpvagtlmveptesedkaeldrfcdamisirqeiadieegridprvnplkmsphsltcvtsshwdrpysrevaafplpfvkpenk
Additional Information
| SKU | 10287325 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB21084 |
